Lineage for d4arxc3 (4arx C:463-609)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775021Species Bacillus thuringiensis [TaxId:29339] [256191] (2 PDB entries)
  8. 2775024Domain d4arxc3: 4arx C:463-609 [251116]
    Other proteins in same PDB: d4arxa1, d4arxa2, d4arxb1, d4arxb2, d4arxc1, d4arxc2, d4arxd1, d4arxd2
    automated match to d1ciya1
    complexed with 13d, gol

Details for d4arxc3

PDB Entry: 4arx (more details), 2.35 Å

PDB Description: lepidoptera-specific toxin cry1ac from bacillus thuringiensis ssp. kurstaki hd-73
PDB Compounds: (C:) pesticidal crystal protein cry1ac

SCOPe Domain Sequences for d4arxc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4arxc3 b.18.1.0 (C:463-609) automated matches {Bacillus thuringiensis [TaxId: 29339]}
nniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqnrgyievpihfps
tstryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdfgyfesanaftss
lgnivgvrnfsgtagviidrfefipvt

SCOPe Domain Coordinates for d4arxc3:

Click to download the PDB-style file with coordinates for d4arxc3.
(The format of our PDB-style files is described here.)

Timeline for d4arxc3: