Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Bacillus thuringiensis [TaxId:29339] [256191] (2 PDB entries) |
Domain d4arxc3: 4arx C:463-609 [251116] Other proteins in same PDB: d4arxa1, d4arxa2, d4arxb1, d4arxb2, d4arxc1, d4arxc2, d4arxd1, d4arxd2 automated match to d1ciya1 complexed with 13d, gol |
PDB Entry: 4arx (more details), 2.35 Å
SCOPe Domain Sequences for d4arxc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4arxc3 b.18.1.0 (C:463-609) automated matches {Bacillus thuringiensis [TaxId: 29339]} nniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqnrgyievpihfps tstryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdfgyfesanaftss lgnivgvrnfsgtagviidrfefipvt
Timeline for d4arxc3: