Lineage for d4arxb1 (4arx B:32-255)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1695625Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1695662Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) (S)
    automatically mapped to Pfam PF03945
  5. 1695663Family f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain [56850] (2 proteins)
    seven-helical bundle with central helix surrounded by six others
  6. 1695673Protein automated matches [254738] (2 species)
    not a true protein
  7. 1695678Species Bacillus thuringiensis [TaxId:29339] [256189] (1 PDB entry)
  8. 1695680Domain d4arxb1: 4arx B:32-255 [251111]
    Other proteins in same PDB: d4arxa2, d4arxa3, d4arxb2, d4arxb3, d4arxc2, d4arxc3, d4arxd2, d4arxd3
    automated match to d1ciya3
    complexed with 13d, gol

Details for d4arxb1

PDB Entry: 4arx (more details), 2.35 Å

PDB Description: lepidoptera-specific toxin cry1ac from bacillus thuringiensis ssp. kurstaki hd-73
PDB Compounds: (B:) pesticidal crystal protein cry1ac

SCOPe Domain Sequences for d4arxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4arxb1 f.1.3.1 (B:32-255) automated matches {Bacillus thuringiensis [TaxId: 29339]}
gytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieef
arnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfavq
nyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwy
ntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrry

SCOPe Domain Coordinates for d4arxb1:

Click to download the PDB-style file with coordinates for d4arxb1.
(The format of our PDB-style files is described here.)

Timeline for d4arxb1: