Lineage for d4arxa2 (4arx A:256-462)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1805894Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 1805901Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) (S)
  5. 1805914Family b.77.2.0: automated matches [254290] (1 protein)
    not a true family
  6. 1805915Protein automated matches [254673] (3 species)
    not a true protein
  7. 1805925Species Bacillus thuringiensis [TaxId:29339] [256190] (2 PDB entries)
  8. 1805926Domain d4arxa2: 4arx A:256-462 [251109]
    Other proteins in same PDB: d4arxa1, d4arxa3, d4arxb1, d4arxb3, d4arxc1, d4arxc3, d4arxd1, d4arxd3
    automated match to d1ciya2
    complexed with 13d, gol

Details for d4arxa2

PDB Entry: 4arx (more details), 2.35 Å

PDB Description: lepidoptera-specific toxin cry1ac from bacillus thuringiensis ssp. kurstaki hd-73
PDB Compounds: (A:) pesticidal crystal protein cry1ac

SCOPe Domain Sequences for d4arxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4arxa2 b.77.2.0 (A:256-462) automated matches {Bacillus thuringiensis [TaxId: 29339]}
pirtvsqltreiytnpvlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyy
wsghqimaspvgfsgpeftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfnigi
nnqqlsvldgtefaygtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsm
frsgfsnssvsiirapmfswihrsaef

SCOPe Domain Coordinates for d4arxa2:

Click to download the PDB-style file with coordinates for d4arxa2.
(The format of our PDB-style files is described here.)

Timeline for d4arxa2: