Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.0: automated matches [196988] (1 protein) not a true family |
Protein automated matches [196989] (16 species) not a true protein |
Species Yersinia kristensenii [TaxId:28152] [256188] (1 PDB entry) |
Domain d4arva_: 4arv A: [251106] automated match to d4arua_ complexed with edo, p15, po4, toe |
PDB Entry: 4arv (more details), 1.67 Å
SCOPe Domain Sequences for d4arva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4arva_ c.60.1.0 (A:) automated matches {Yersinia kristensenii [TaxId: 28152]} gytlervvilsrhgvrsptkqtqlmndvtpdkwpqwpvkagyltprgaglvtlmggfygd yfrsygllpagcpadesiyvqadvdqrtrltgqafldgiapdcglkvhyqadlkkidplf htveagvckldpekthqavekrlggplnelsqryakpfalmgevlnfsaspycnslqqkg kacdfatfaaneievnkegtkvslsgplalsstlgeifllqnsqampdvawnrlsgeenw isllslhnaqfdlmaktpyiarhkgtpllqqidtalvlqrdaqgqtlplspqtkllflgg hdtnianiagmlganwqlpqqpdntppggglvfelwqnpdnhqryvavkmfyqtmeqlrn adkldlknnparivpiaiegcenegdnklcqletfqkkvaqviepschi
Timeline for d4arva_: