Lineage for d4apqc2 (4apq C:120-206)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1763988Domain d4apqc2: 4apq C:120-206 [251102]
    Other proteins in same PDB: d4apqa1, d4apqa2, d4apqb_, d4apqc1, d4apqd1, d4apqd2
    automated match to d4eura2
    complexed with cis

Details for d4apqc2

PDB Entry: 4apq (more details), 3 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-sulfatide
PDB Compounds: (C:) mouse nkt tcr valpha14, human nkt tcr valpha14

SCOPe Domain Sequences for d4apqc2:

Sequence, based on SEQRES records: (download)

>d4apqc2 b.1.1.2 (C:120-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtff

Sequence, based on observed residues (ATOM records): (download)

>d4apqc2 b.1.1.2 (C:120-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsacanafnnsiipedtff

SCOPe Domain Coordinates for d4apqc2:

Click to download the PDB-style file with coordinates for d4apqc2.
(The format of our PDB-style files is described here.)

Timeline for d4apqc2: