SCOP 1.61: Domain d1dm0f_: 1dm0 F:

Lineage for d1dm0f_ (1dm0 F:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species)

7. Species Shigella dysenteriae [TaxId:622] [50212] (2 PDB entries)

8. Domain d1dm0f_: 1dm0 F: [25110]
   Other proteins in same PDB: d1dm0a_, d1dm0l_

Details for d1dm0f_

PDB Entry: 1dm0, 2.5 Å

PDB Description: shiga toxin

SCOP Domain Sequences for d1dm0f_:

Sequence; same for both SEQRES and ATOM records:

>d1dm0f_ b.40.2.1 (F:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

Timeline for d1dm0f_:

• d1dm0f_ first appeared (with stable ids) in SCOP 1.55
  
• d1dm0f_ appears in SCOP 1.59
  
• d1dm0f_ appears in SCOP 1.63
  
• d1dm0f_ appears in the current release, SCOPe 2.08