SCOPe 2.05: Domain d4anxa3: 4anx A:544-725

Lineage for d4anxa3 (4anx A:544-725)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189070] (29 PDB entries)

8. Domain d4anxa3: 4anx A:544-725 [251093]
   Other proteins in same PDB: d4anxa1, d4anxa2, d4anxa4
   automated match to d1e7ua1
   complexed with 534

Details for d4anxa3

PDB Entry: 4anx, 2.73 Å

PDB Description: complexes of pi3kgamma with isoform selective inhibitors.

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4anxa3:

Sequence; same for both SEQRES and ATOM records:

>d4anxa3 a.118.1.0 (A:544-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqei
vaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllql
vqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrg
cg

Timeline for d4anxa3:

• d4anxa3 first appeared in SCOPe 2.04
  
• d4anxa3 appears in SCOPe 2.06
  
• d4anxa3 appears in the current release, SCOPe 2.08