SCOPe 2.04: Domain d4anxa1: 4anx A:143-321

Lineage for d4anxa1 (4anx A:143-321)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (41 PDB entries)

8. Domain d4anxa1: 4anx A:143-321 [251091]
   Other proteins in same PDB: d4anxa2, d4anxa3, d4anxa4
   automated match to d1e7ua3
   complexed with 534

Details for d4anxa1

PDB Entry: 4anx, 2.73 Å

PDB Description: complexes of pi3kgamma with isoform selective inhibitors.

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4anxa1:

Sequence, based on SEQRES records:

>d4anxa1 d.15.1.0 (A:143-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records):

>d4anxa1 d.15.1.0 (A:143-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmeqdfvlrvcg
rdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Timeline for d4anxa1:

• d4anxa1 is new in SCOPe 2.04-stable
  
• d4anxa1 appears in SCOPe 2.05
  
• d4anxa1 appears in the current release, SCOPe 2.08