Class b: All beta proteins [48724] (180 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) two constituent families are related by circular permutation |
Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
Protein automated matches [190497] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188711] (30 PDB entries) |
Domain d4anwa2: 4anw A:357-522 [251088] Other proteins in same PDB: d4anwa1, d4anwa3, d4anwa4, d4anwa5 automated match to d1e8wa2 complexed with o92, so4 |
PDB Entry: 4anw (more details), 2.31 Å
SCOPe Domain Sequences for d4anwa2:
Sequence, based on SEQRES records: (download)
>d4anwa2 b.7.1.0 (A:357-522) automated matches {Human (Homo sapiens) [TaxId: 9606]} cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef sikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidhrfllr rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn
>d4anwa2 b.7.1.0 (A:357-522) automated matches {Human (Homo sapiens) [TaxId: 9606]} cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef sikikdlpkgallnlqiycqllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsat npdkensmsisilldn
Timeline for d4anwa2:
View in 3D Domains from same chain: (mouse over for more information) d4anwa1, d4anwa3, d4anwa4, d4anwa5 |