SCOPe 2.08: Domain d4anwa1: 4anw A:144-321

Lineage for d4anwa1 (4anw A:144-321)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)

8. Domain d4anwa1: 4anw A:144-321 [251087]
   Other proteins in same PDB: d4anwa2, d4anwa3, d4anwa4, d4anwa5
   automated match to d1e7ua3
   complexed with o92, so4

Details for d4anwa1

PDB Entry: 4anw, 2.31 Å

PDB Description: complexes of pi3kgamma with isoform selective inhibitors.

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4anwa1:

Sequence, based on SEQRES records:

>d4anwa1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records):

>d4anwa1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmeqdfvlrvcgr
deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Timeline for d4anwa1:

• d4anwa1 first appeared in SCOPe 2.04
  
• d4anwa1 appears in SCOPe 2.07