![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (27 families) ![]() |
![]() | Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
![]() | Protein automated matches [190220] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189070] (47 PDB entries) |
![]() | Domain d4anva3: 4anv A:525-725 [251085] Other proteins in same PDB: d4anva1, d4anva2, d4anva4 automated match to d1e7ua1 complexed with 751, so4 |
PDB Entry: 4anv (more details), 2.13 Å
SCOPe Domain Sequences for d4anva3:
Sequence, based on SEQRES records: (download)
>d4anva3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]} hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia qsrhyqqrfavileaylrgcg
>d4anva3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]} hpialpkhqraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfs svkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledd dvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfa vileaylrgcg
Timeline for d4anva3: