SCOPe 2.05: Domain d4anua3: 4anu A:544-725

Lineage for d4anua3 (4anu A:544-725)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189070] (29 PDB entries)

8. Domain d4anua3: 4anu A:544-725 [251081]
   Other proteins in same PDB: d4anua1, d4anua2, d4anua4
   automated match to d1e7ua1
   complexed with em7, so4

Details for d4anua3

PDB Entry: 4anu, 2.81 Å

PDB Description: Complexes of PI3Kgamma with isoform selective inhibitors.

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4anua3:

Sequence; same for both SEQRES and ATOM records:

>d4anua3 a.118.1.0 (A:544-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqei
vaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllql
vqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrg
cg

Timeline for d4anua3:

• d4anua3 first appeared in SCOPe 2.04
  
• d4anua3 appears in SCOPe 2.06
  
• d4anua3 appears in the current release, SCOPe 2.08