Lineage for d4am0r_ (4am0 R:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039515Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2039516Protein automated matches [190226] (55 species)
    not a true protein
  7. 2039615Species Dengue virus [TaxId:11070] [256185] (1 PDB entry)
  8. 2039617Domain d4am0r_: 4am0 R: [251076]
    Other proteins in same PDB: d4am0b1, d4am0b2, d4am0d1, d4am0d2, d4am0f1, d4am0f2, d4am0l1, d4am0l2
    automated match to d1pjwa_

Details for d4am0r_

PDB Entry: 4am0 (more details), 3.02 Å

PDB Description: structure of dengue virus strain 4 diii in complex with fab 2h12
PDB Compounds: (R:) envelope protein,

SCOPe Domain Sequences for d4am0r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4am0r_ b.1.18.0 (R:) automated matches {Dengue virus [TaxId: 11070]}
tmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpfae
ytnsvtnieleppfgdsyivigvgdsaltlhwfrkg

SCOPe Domain Coordinates for d4am0r_:

Click to download the PDB-style file with coordinates for d4am0r_.
(The format of our PDB-style files is described here.)

Timeline for d4am0r_: