Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (18 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries) |
Domain d4am0f1: 4am0 F:1-107 [251071] Other proteins in same PDB: d4am0b2, d4am0d2, d4am0f2, d4am0l2, d4am0q_, d4am0r_, d4am0s_, d4am0t_ automated match to d12e8l1 |
PDB Entry: 4am0 (more details), 3.02 Å
SCOPe Domain Sequences for d4am0f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4am0f1 b.1.1.1 (F:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} divmtqsqkfmstsvgdrvsitckasqnvrtsvawyqqkpgqspkaliylasnrhtgvpd rftgsgsgtdftltisnvqsedladyfclqhwtypytfgggtkleik
Timeline for d4am0f1: