Lineage for d4am0d1 (4am0 D:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1512787Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)
  8. 1512965Domain d4am0d1: 4am0 D:1-107 [251069]
    Other proteins in same PDB: d4am0b2, d4am0d2, d4am0f2, d4am0l2, d4am0q_, d4am0r_, d4am0s_, d4am0t_
    automated match to d12e8l1

Details for d4am0d1

PDB Entry: 4am0 (more details), 3.02 Å

PDB Description: structure of dengue virus strain 4 diii in complex with fab 2h12
PDB Compounds: (D:) fab 2h12, light chain

SCOPe Domain Sequences for d4am0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4am0d1 b.1.1.1 (D:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsqkfmstsvgdrvsitckasqnvrtsvawyqqkpgqspkaliylasnrhtgvpd
rftgsgsgtdftltisnvqsedladyfclqhwtypytfgggtkleik

SCOPe Domain Coordinates for d4am0d1:

Click to download the PDB-style file with coordinates for d4am0d1.
(The format of our PDB-style files is described here.)

Timeline for d4am0d1: