SCOPe 2.05: Domain d4akoa3: 4ako A:357-511

Lineage for d4akoa3 (4ako A:357-511)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (21 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [255666] (7 PDB entries)

8. Domain d4akoa3: 4ako A:357-511 [251054]
   automated match to d1gska3
   complexed with cu, edo, oxy; mutant

Details for d4akoa3

PDB Entry: 4ako, 1.7 Å

PDB Description: Mutations in the neighbourhood of CotA-laccase trinuclear site: E498L mutant

PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d4akoa3:

Sequence; same for both SEQRES and ATOM records:

>d4akoa3 b.6.1.0 (A:357-511) automated matches {Bacillus subtilis [TaxId: 1423]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehldydmmrpmditdp

Timeline for d4akoa3:

• d4akoa3 first appeared in SCOPe 2.04
  
• d4akoa3 appears in SCOPe 2.06
  
• d4akoa3 appears in the current release, SCOPe 2.08