Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (21 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [255666] (7 PDB entries) |
Domain d4akoa3: 4ako A:357-511 [251054] automated match to d1gska3 complexed with cu, edo, oxy; mutant |
PDB Entry: 4ako (more details), 1.7 Å
SCOPe Domain Sequences for d4akoa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4akoa3 b.6.1.0 (A:357-511) automated matches {Bacillus subtilis [TaxId: 1423]} sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr iaatfgpysgryvwhchilehldydmmrpmditdp
Timeline for d4akoa3: