Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins) Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain |
Protein automated matches [254553] (2 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:226186] [255268] (4 PDB entries) |
Domain d4aiua2: 4aiu A:127-436 [251042] Other proteins in same PDB: d4aiua1, d4aiua3 automated match to d2choa2 complexed with ca, gc3 |
PDB Entry: 4aiu (more details), 2.25 Å
SCOPe Domain Sequences for d4aiua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aiua2 c.1.8.10 (A:127-436) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffndisg egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns dlgpnghgyr
Timeline for d4aiua2: