Lineage for d4aiua2 (4aiu A:127-436)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832135Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2832193Protein automated matches [254553] (3 species)
    not a true protein
  7. 2832194Species Bacteroides thetaiotaomicron [TaxId:226186] [255268] (4 PDB entries)
  8. 2832198Domain d4aiua2: 4aiu A:127-436 [251042]
    Other proteins in same PDB: d4aiua1, d4aiua3
    automated match to d2choa2
    complexed with ca, gc3

Details for d4aiua2

PDB Entry: 4aiu (more details), 2.25 Å

PDB Description: A complex structure of BtGH84
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d4aiua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aiua2 c.1.8.10 (A:127-436) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffndisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

SCOPe Domain Coordinates for d4aiua2:

Click to download the PDB-style file with coordinates for d4aiua2.
(The format of our PDB-style files is described here.)

Timeline for d4aiua2: