SCOPe 2.07: Domain d4aiua1: 4aiu A:4-126

Lineage for d4aiua1 (4aiu A:4-126)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.0: automated matches [227269] (1 protein)
   not a true family

6. Protein automated matches [227062] (5 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [255267] (4 PDB entries)

8. Domain d4aiua1: 4aiu A:4-126 [251041]
   Other proteins in same PDB: d4aiua2, d4aiua3
   automated match to d2vvna3
   complexed with ca, gc3

Details for d4aiua1

PDB Entry: 4aiu, 2.25 Å

PDB Description: A complex structure of BtGH84

PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d4aiua1:

Sequence, based on SEQRES records:

>d4aiua1 d.92.2.0 (A:4-126) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps

Sequence, based on observed residues (ATOM records):

>d4aiua1 d.92.2.0 (A:4-126) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkys
rqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps

Timeline for d4aiua1:

• d4aiua1 first appeared in SCOPe 2.04
  
• d4aiua1 appears in SCOPe 2.06
  
• d4aiua1 appears in the current release, SCOPe 2.08