Lineage for d4aiua1 (4aiu A:4-126)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2571709Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2571811Family d.92.2.0: automated matches [227269] (1 protein)
    not a true family
  6. 2571812Protein automated matches [227062] (5 species)
    not a true protein
  7. 2571813Species Bacteroides thetaiotaomicron [TaxId:226186] [255267] (4 PDB entries)
  8. 2571817Domain d4aiua1: 4aiu A:4-126 [251041]
    Other proteins in same PDB: d4aiua2, d4aiua3
    automated match to d2vvna3
    complexed with ca, gc3

Details for d4aiua1

PDB Entry: 4aiu (more details), 2.25 Å

PDB Description: A complex structure of BtGH84
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d4aiua1:

Sequence, based on SEQRES records: (download)

>d4aiua1 d.92.2.0 (A:4-126) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps

Sequence, based on observed residues (ATOM records): (download)

>d4aiua1 d.92.2.0 (A:4-126) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkys
rqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps

SCOPe Domain Coordinates for d4aiua1:

Click to download the PDB-style file with coordinates for d4aiua1.
(The format of our PDB-style files is described here.)

Timeline for d4aiua1: