Lineage for d1qnud_ (1qnu D:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166278Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 166279Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 166496Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species)
  7. 166589Species Shigella dysenteriae [TaxId:622] [50212] (2 PDB entries)
  8. 166593Domain d1qnud_: 1qnu D: [25104]

Details for d1qnud_

PDB Entry: 1qnu (more details), 2.23 Å

PDB Description: shiga-like toxin i b subunit complexed with the bridged-starfish inhibitor

SCOP Domain Sequences for d1qnud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnud_ b.40.2.1 (D:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOP Domain Coordinates for d1qnud_:

Click to download the PDB-style file with coordinates for d1qnud_.
(The format of our PDB-style files is described here.)

Timeline for d1qnud_: