Lineage for d4af1a3 (4af1 A:278-416)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566728Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2566863Family d.79.3.0: automated matches [254304] (1 protein)
    not a true family
  6. 2566864Protein automated matches [254705] (2 species)
    not a true protein
  7. 2566867Species Halobacterium salinarum [TaxId:478009] [256182] (1 PDB entry)
  8. 2566868Domain d4af1a3: 4af1 A:278-416 [251022]
    Other proteins in same PDB: d4af1a1, d4af1a2
    automated match to d1dt9a2
    complexed with zn

Details for d4af1a3

PDB Entry: 4af1 (more details), 2 Å

PDB Description: archeal release factor arf1
PDB Compounds: (A:) Peptide chain release factor subunit 1

SCOPe Domain Sequences for d4af1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4af1a3 d.79.3.0 (A:278-416) automated matches {Halobacterium salinarum [TaxId: 478009]}
eadlmddksdmeeffeelnggklatygfeqtrrnlimgsvdrllvsedlredvviyecpn
dheeyetidrrntspehtcsdcgeeatevdredaidhlmsiadqrgtethfistdfekge
qlltafggyagilrystgv

SCOPe Domain Coordinates for d4af1a3:

Click to download the PDB-style file with coordinates for d4af1a3.
(The format of our PDB-style files is described here.)

Timeline for d4af1a3: