SCOPe 2.06: Domain d4af1a3: 4af1 A:278-416

Lineage for d4af1a3 (4af1 A:278-416)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (4 families)

5. Family d.79.3.0: automated matches [254304] (1 protein)
   not a true family

6. Protein automated matches [254705] (2 species)
   not a true protein

7. Species Halobacterium salinarum [TaxId:478009] [256182] (1 PDB entry)

8. Domain d4af1a3: 4af1 A:278-416 [251022]
   Other proteins in same PDB: d4af1a1, d4af1a2
   automated match to d1dt9a2
   complexed with zn

Details for d4af1a3

PDB Entry: 4af1, 2 Å

PDB Description: archeal release factor arf1

PDB Compounds: (A:) Peptide chain release factor subunit 1

SCOPe Domain Sequences for d4af1a3:

Sequence; same for both SEQRES and ATOM records:

>d4af1a3 d.79.3.0 (A:278-416) automated matches {Halobacterium salinarum [TaxId: 478009]}
eadlmddksdmeeffeelnggklatygfeqtrrnlimgsvdrllvsedlredvviyecpn
dheeyetidrrntspehtcsdcgeeatevdredaidhlmsiadqrgtethfistdfekge
qlltafggyagilrystgv

Timeline for d4af1a3:

• d4af1a3 first appeared in SCOPe 2.04
  
• d4af1a3 appears in SCOPe 2.05
  
• d4af1a3 appears in SCOPe 2.07
  
• d4af1a3 appears in the current release, SCOPe 2.08