Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) |
Family c.55.4.0: automated matches [254303] (1 protein) not a true family |
Protein automated matches [254704] (2 species) not a true protein |
Species Halobacterium salinarum [TaxId:478009] [256181] (1 PDB entry) |
Domain d4af1a2: 4af1 A:145-277 [251021] Other proteins in same PDB: d4af1a1, d4af1a3 automated match to d1dt9a1 complexed with zn |
PDB Entry: 4af1 (more details), 2 Å
SCOPe Domain Sequences for d4af1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4af1a2 c.55.4.0 (A:145-277) automated matches {Halobacterium salinarum [TaxId: 478009]} kglyglivldrresnvgwlkgkrvqpvksaeslvpgkqrkggqsaqrfarlrleaidnfy qevagmaddlfvpkrheidgilvggpsptkdefldgdylhhelqdkvlgkfdvsytdesg lsdlvdagqaala
Timeline for d4af1a2: