Lineage for d4af1a1 (4af1 A:7-144)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963570Fold d.91: N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 [55480] (1 superfamily)
    alpha-beta-alpha(2)-beta(3)-alpha; 3 layers a/b/a; antiparallel beta-sheet: 4123
  4. 2963571Superfamily d.91.1: N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 [55481] (2 families) (S)
    automatically mapped to Pfam PF03463
  5. 2963576Family d.91.1.0: automated matches [254322] (1 protein)
    not a true family
  6. 2963577Protein automated matches [254736] (1 species)
    not a true protein
  7. 2963578Species Halobacterium salinarum [TaxId:478009] [256180] (1 PDB entry)
  8. 2963579Domain d4af1a1: 4af1 A:7-144 [251020]
    Other proteins in same PDB: d4af1a2, d4af1a3
    automated match to d1dt9a3
    complexed with zn

Details for d4af1a1

PDB Entry: 4af1 (more details), 2 Å

PDB Description: archeal release factor arf1
PDB Compounds: (A:) Peptide chain release factor subunit 1

SCOPe Domain Sequences for d4af1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4af1a1 d.91.1.0 (A:7-144) automated matches {Halobacterium salinarum [TaxId: 478009]}
vpsedrrkyefrkvieelkdyegsgtqlvtiyippdkqisdvvahvtqehseasnikskq
trtnvqdaltsikdrlryydtfppdngmvvfsgavdsgggrtdmvtevlesppqpiesfr
yhcdsaflteplaemlgd

SCOPe Domain Coordinates for d4af1a1:

Click to download the PDB-style file with coordinates for d4af1a1.
(The format of our PDB-style files is described here.)

Timeline for d4af1a1: