![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
![]() | Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species) phage-borne toxin; bacteriophages H30 and H19B |
![]() | Species Shigella dysenteriae [TaxId:622] [50212] (2 PDB entries) identical sequence with verotoxin-1 B |
![]() | Domain d1qnub_: 1qnu B: [25102] |
PDB Entry: 1qnu (more details), 2.23 Å
SCOP Domain Sequences for d1qnub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qnub_ b.40.2.1 (B:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae} tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng ggfsevifr
Timeline for d1qnub_:
![]() Domains from other chains: (mouse over for more information) d1qnua_, d1qnuc_, d1qnud_, d1qnue_ |