Lineage for d1qnub_ (1qnu B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788585Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 2788714Species Shigella dysenteriae, toxin I [TaxId:622] [50212] (3 PDB entries)
    identical sequence with verotoxin-1 B
  8. 2788716Domain d1qnub_: 1qnu B: [25102]
    complexed with emb, mec

Details for d1qnub_

PDB Entry: 1qnu (more details), 2.23 Å

PDB Description: shiga-like toxin i b subunit complexed with the bridged-starfish inhibitor
PDB Compounds: (B:) Shiga toxin 1 variant B subunit

SCOPe Domain Sequences for d1qnub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnub_ b.40.2.1 (B:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin I [TaxId: 622]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOPe Domain Coordinates for d1qnub_:

Click to download the PDB-style file with coordinates for d1qnub_.
(The format of our PDB-style files is described here.)

Timeline for d1qnub_: