Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) automatically mapped to Pfam PF02764 |
Family f.1.2.0: automated matches [254320] (1 protein) not a true family |
Protein automated matches [254734] (1 species) not a true protein |
Species Corynebacterium diphtheriae [TaxId:1717] [256177] (7 PDB entries) |
Domain d4ae1b2: 4ae1 B:201-380 [251015] Other proteins in same PDB: d4ae1a1, d4ae1a3, d4ae1b1, d4ae1b3 automated match to d1ddta3 complexed with nca; mutant |
PDB Entry: 4ae1 (more details), 2.08 Å
SCOPe Domain Sequences for d4ae1b2:
Sequence, based on SEQRES records: (download)
>d4ae1b2 f.1.2.0 (B:201-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} cinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpel selktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadga vhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpay
>d4ae1b2 f.1.2.0 (B:201-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} cinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpel selktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadga vhhnteeivaqsialsslmvaqaiplvgelvgfaaynfvesiinlfqvvhnsynrpay
Timeline for d4ae1b2: