Lineage for d4ae1b1 (4ae1 B:3-187)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234147Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2234148Protein automated matches [191197] (9 species)
    not a true protein
  7. 2234191Species Corynebacterium diphtheriae [TaxId:1717] [256176] (3 PDB entries)
  8. 2234194Domain d4ae1b1: 4ae1 B:3-187 [251014]
    Other proteins in same PDB: d4ae1a2, d4ae1a3, d4ae1b2, d4ae1b3
    automated match to d1f0la2
    complexed with nca; mutant

Details for d4ae1b1

PDB Entry: 4ae1 (more details), 2.08 Å

PDB Description: Crystal structure of diphtheria toxin mutant CRM197 in complex with nicotinamide
PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d4ae1b1:

Sequence, based on SEQRES records: (download)

>d4ae1b1 d.166.1.0 (B:3-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
ddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkefystdnkyda
agysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgtee
fikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamyeym
aqaca

Sequence, based on observed residues (ATOM records): (download)

>d4ae1b1 d.166.1.0 (B:3-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
ddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkkefystdnkydaagysvdnenplsg
kaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgteefikrfgdgasrvv
lslpfaegsssveyinnweqakalsveleinfetrgkrgqdamyeymaqaca

SCOPe Domain Coordinates for d4ae1b1:

Click to download the PDB-style file with coordinates for d4ae1b1.
(The format of our PDB-style files is described here.)

Timeline for d4ae1b1: