Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (7 species) not a true protein |
Species Corynebacterium diphtheriae [TaxId:1717] [256176] (2 PDB entries) |
Domain d4ae1b1: 4ae1 B:3-187 [251014] Other proteins in same PDB: d4ae1a2, d4ae1a3, d4ae1b2, d4ae1b3 automated match to d1f0la2 complexed with nca; mutant |
PDB Entry: 4ae1 (more details), 2.08 Å
SCOPe Domain Sequences for d4ae1b1:
Sequence, based on SEQRES records: (download)
>d4ae1b1 d.166.1.0 (B:3-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} ddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkefystdnkyda agysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgtee fikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamyeym aqaca
>d4ae1b1 d.166.1.0 (B:3-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} ddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkkefystdnkydaagysvdnenplsg kaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgteefikrfgdgasrvv lslpfaegsssveyinnweqakalsveleinfetrgkrgqdamyeymaqaca
Timeline for d4ae1b1: