SCOP 1.61: Domain d1qnua_: 1qnu A:

Lineage for d1qnua_ (1qnu A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species)

7. Species Shigella dysenteriae [TaxId:622] [50212] (2 PDB entries)

8. Domain d1qnua_: 1qnu A: [25101]

Details for d1qnua_

PDB Entry: 1qnu, 2.23 Å

PDB Description: shiga-like toxin i b subunit complexed with the bridged-starfish inhibitor

SCOP Domain Sequences for d1qnua_:

Sequence; same for both SEQRES and ATOM records:

>d1qnua_ b.40.2.1 (A:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

Timeline for d1qnua_:

• d1qnua_ first appeared (with stable ids) in SCOP 1.55
  
• d1qnua_ appears in SCOP 1.59
  
• d1qnua_ appears in SCOP 1.63
  
• d1qnua_ appears in the current release, SCOPe 2.08