Lineage for d4addd_ (4add D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2148742Species Escherichia coli [TaxId:511693] [234051] (4 PDB entries)
  8. 2148754Domain d4addd_: 4add D: [250993]
    automated match to d4adba_
    complexed with plp, suo

Details for d4addd_

PDB Entry: 4add (more details), 2.45 Å

PDB Description: structural and functional study of succinyl-ornithine transaminase from e. coli
PDB Compounds: (D:) succinylornithine transaminase

SCOPe Domain Sequences for d4addd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4addd_ c.67.1.0 (D:) automated matches {Escherichia coli [TaxId: 511693]}
qpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpelre
alneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfahd
rygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasalidd
stcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymhyg
vtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelintp
emlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaakag
vmvliaggnvvrfapalnvseeevttgldrfaaacehfvs

SCOPe Domain Coordinates for d4addd_:

Click to download the PDB-style file with coordinates for d4addd_.
(The format of our PDB-style files is described here.)

Timeline for d4addd_: