Lineage for d4a76g1 (4a76 G:27-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790721Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [256121] (3 PDB entries)
  8. 2790731Domain d4a76g1: 4a76 G:27-113 [250970]
    Other proteins in same PDB: d4a76g2
    automated match to d4a4ib_
    protein/DNA complex

Details for d4a76g1

PDB Entry: 4a76 (more details), 1.92 Å

PDB Description: the lin28b cold shock domain in complex with heptathymidine
PDB Compounds: (G:) lin28 cold shock domain

SCOPe Domain Sequences for d4a76g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a76g1 b.40.4.0 (G:27-113) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
dpqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkegepv
eftfkksskgfeslrvtgpggnpclgn

SCOPe Domain Coordinates for d4a76g1:

Click to download the PDB-style file with coordinates for d4a76g1.
(The format of our PDB-style files is described here.)

Timeline for d4a76g1: