Lineage for d4a73c1 (4a73 C:22-164)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108959Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)
  8. 2109003Domain d4a73c1: 4a73 C:22-164 [250959]
    Other proteins in same PDB: d4a73a2, d4a73b2, d4a73c2, d4a73d2
    automated match to d2v7pa1
    mutant

Details for d4a73c1

PDB Entry: 4a73 (more details), 3 Å

PDB Description: single point mutant of thermus thermophilus lactate dehydrogenase
PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4a73c1:

Sequence, based on SEQRES records: (download)

>d4a73c1 c.2.1.0 (C:22-164) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsglppgrvvgsg

Sequence, based on observed residues (ATOM records): (download)

>d4a73c1 c.2.1.0 (C:22-164) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrllldrnaqvfaqvvprvleaapeavllvatnpvdv
mtqvayrlsglppgrvvgsg

SCOPe Domain Coordinates for d4a73c1:

Click to download the PDB-style file with coordinates for d4a73c1.
(The format of our PDB-style files is described here.)

Timeline for d4a73c1: