Lineage for d4a67a2 (4a67 A:183-356)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772327Species Bacillus subtilis [TaxId:1423] [255666] (7 PDB entries)
  8. 2772347Domain d4a67a2: 4a67 A:183-356 [250940]
    automated match to d1gska2
    complexed with cu, per; mutant

Details for d4a67a2

PDB Entry: 4a67 (more details), 2.1 Å

PDB Description: Mutations in the neighbourhood of CotA-laccase trinuclear site: D116E mutant
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d4a67a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a67a2 b.6.1.0 (A:183-356) automated matches {Bacillus subtilis [TaxId: 1423]}
klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy
leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi
iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla

SCOPe Domain Coordinates for d4a67a2:

Click to download the PDB-style file with coordinates for d4a67a2.
(The format of our PDB-style files is described here.)

Timeline for d4a67a2: