Lineage for d4a66a1 (4a66 A:2-182)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1775547Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 1775548Protein automated matches [190824] (21 species)
    not a true protein
  7. 1775622Species Bacillus subtilis [TaxId:1423] [255666] (7 PDB entries)
  8. 1775629Domain d4a66a1: 4a66 A:2-182 [250936]
    automated match to d1gska1
    complexed with cu, edo, per; mutant

Details for d4a66a1

PDB Entry: 4a66 (more details), 1.95 Å

PDB Description: Mutations in the neighbourhood of CotA-laccase trinuclear site: D116A mutant
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d4a66a1:

Sequence, based on SEQRES records: (download)

>d4a66a1 b.6.1.0 (A:2-182) automated matches {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsagypea
wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr
l

Sequence, based on observed residues (ATOM records): (download)

>d4a66a1 b.6.1.0 (A:2-182) automated matches {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihheepevktvvhlhggvtpddsagypeawfskd
feqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

SCOPe Domain Coordinates for d4a66a1:

Click to download the PDB-style file with coordinates for d4a66a1.
(The format of our PDB-style files is described here.)

Timeline for d4a66a1: