SCOPe 2.04: Domain d4a2uh2: 4a2u H:145-224

Lineage for d4a2uh2 (4a2u H:145-224)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (52 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries)

8. Domain d4a2uh2: 4a2u H:145-224 [250915]
   Other proteins in same PDB: d4a2ua1, d4a2ub1, d4a2uc1, d4a2ud1, d4a2ue1, d4a2uf1, d4a2ug1, d4a2uh1
   automated match to d3d0sa2
   complexed with cmp

Details for d4a2uh2

PDB Entry: 4a2u, 2.63 Å

PDB Description: CRP(CAP) from Myco. Tuberculosis, with cAMP

PDB Compounds: (H:) probable transcriptional regulatory protein (probably crp/ fnr-family)

SCOPe Domain Sequences for d4a2uh2:

Sequence; same for both SEQRES and ATOM records:

>d4a2uh2 a.4.5.0 (H:145-224) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisdserlarrar

Timeline for d4a2uh2:

• d4a2uh2 is new in SCOPe 2.04-stable
  
• d4a2uh2 appears in SCOPe 2.05
  
• d4a2uh2 appears in the current release, SCOPe 2.08