Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (14 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [231918] (4 PDB entries) |
Domain d4a2uh1: 4a2u H:1-144 [250914] Other proteins in same PDB: d4a2ua2, d4a2ub2, d4a2uc2, d4a2ud2, d4a2ue2, d4a2uf2, d4a2uf3, d4a2ug2, d4a2uh2, d4a2uh3 automated match to d3d0sa1 complexed with cmp |
PDB Entry: 4a2u (more details), 2.63 Å
SCOPe Domain Sequences for d4a2uh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a2uh1 b.82.3.0 (H:1-144) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis eqllrvlarrlrrtnnnladlift
Timeline for d4a2uh1: