Lineage for d4a2uh1 (4a2u H:1-144)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082002Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2082241Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2082242Protein automated matches [226927] (14 species)
    not a true protein
  7. 2082290Species Mycobacterium tuberculosis [TaxId:1773] [231918] (4 PDB entries)
  8. 2082306Domain d4a2uh1: 4a2u H:1-144 [250914]
    Other proteins in same PDB: d4a2ua2, d4a2ub2, d4a2uc2, d4a2ud2, d4a2ue2, d4a2uf2, d4a2uf3, d4a2ug2, d4a2uh2, d4a2uh3
    automated match to d3d0sa1
    complexed with cmp

Details for d4a2uh1

PDB Entry: 4a2u (more details), 2.63 Å

PDB Description: CRP(CAP) from Myco. Tuberculosis, with cAMP
PDB Compounds: (H:) probable transcriptional regulatory protein (probably crp/ fnr-family)

SCOPe Domain Sequences for d4a2uh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a2uh1 b.82.3.0 (H:1-144) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
eqllrvlarrlrrtnnnladlift

SCOPe Domain Coordinates for d4a2uh1:

Click to download the PDB-style file with coordinates for d4a2uh1.
(The format of our PDB-style files is described here.)

Timeline for d4a2uh1: