Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries) |
Domain d4a2ug2: 4a2u G:145-224 [250913] Other proteins in same PDB: d4a2ua1, d4a2ub1, d4a2uc1, d4a2ud1, d4a2ue1, d4a2uf1, d4a2uf3, d4a2ug1, d4a2uh1, d4a2uh3 automated match to d3d0sa2 complexed with cmp |
PDB Entry: 4a2u (more details), 2.63 Å
SCOPe Domain Sequences for d4a2ug2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a2ug2 a.4.5.0 (G:145-224) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi rlegksvlisdserlarrar
Timeline for d4a2ug2: