Lineage for d3zw3a2 (3zw3 A:525-725)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2009600Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2010204Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2010205Protein automated matches [190220] (14 species)
    not a true protein
  7. 2010232Species Human (Homo sapiens) [TaxId:9606] [189070] (42 PDB entries)
  8. 2010250Domain d3zw3a2: 3zw3 A:525-725 [250880]
    Other proteins in same PDB: d3zw3a1, d3zw3a3
    automated match to d1e7ua1
    complexed with zw3

Details for d3zw3a2

PDB Entry: 3zw3 (more details), 2.8 Å

PDB Description: fragment based discovery of a novel and selective pi3 kinase inhibitor
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3zw3a2:

Sequence, based on SEQRES records: (download)

>d3zw3a2 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d3zw3a2 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
ylrgcg

SCOPe Domain Coordinates for d3zw3a2:

Click to download the PDB-style file with coordinates for d3zw3a2.
(The format of our PDB-style files is described here.)

Timeline for d3zw3a2: