Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (42 PDB entries) |
Domain d3zw3a2: 3zw3 A:525-725 [250880] Other proteins in same PDB: d3zw3a1, d3zw3a3 automated match to d1e7ua1 complexed with zw3 |
PDB Entry: 3zw3 (more details), 2.8 Å
SCOPe Domain Sequences for d3zw3a2:
Sequence, based on SEQRES records: (download)
>d3zw3a2 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]} hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia qsrhyqqrfavileaylrgcg
>d3zw3a2 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]} hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea ylrgcg
Timeline for d3zw3a2: