SCOPe 2.05: Domain d3zvva3: 3zvv A:525-725

Lineage for d3zvva3 (3zvv A:525-725)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189070] (29 PDB entries)

8. Domain d3zvva3: 3zvv A:525-725 [250877]
   Other proteins in same PDB: d3zvva1, d3zvva2, d3zvva4
   automated match to d1e7ua1
   complexed with xaz

Details for d3zvva3

PDB Entry: 3zvv, 2.5 Å

PDB Description: fragment bound to pi3kinase gamma

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3zvva3:

Sequence, based on SEQRES records:

>d3zvva3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records):

>d3zvva3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
ylrgcg

Timeline for d3zvva3:

• d3zvva3 first appeared in SCOPe 2.04
  
• d3zvva3 appears in SCOPe 2.06
  
• d3zvva3 appears in the current release, SCOPe 2.08