Lineage for d3zukb_ (3zuk B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530298Species Mycobacterium tuberculosis [TaxId:83332] [256168] (1 PDB entry)
  8. 2530300Domain d3zukb_: 3zuk B: [250846]
    automated match to d3dwba_
    complexed with 211, act, ca, cl, peg, pg4, pge, rdf, so4, zn

Details for d3zukb_

PDB Entry: 3zuk (more details), 2.6 Å

PDB Description: crystal structure of mycobacterium tuberculosis zinc metalloprotease zmp1 in complex with inhibitor
PDB Compounds: (B:) endopeptidase, peptidase family m13

SCOPe Domain Sequences for d3zukb_:

Sequence, based on SEQRES records: (download)

>d3zukb_ d.92.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
aipsgidlshidadarpqddlfghvngrwlaeheipadratdgafrslfdraetqvrdli
iqasqagaavgtdaqrigdlyasfldeeaveragvqplhdelatidsaadatelaaalgt
lqragvgggigvyvdtdskdstrylvhftqsgiglpdesyyrdeqhaavlaaypghiarm
fglvyggesrdhaktadrivaletkladahwdvvkrrdadlgynlrtfaqlqtegagfdw
vswvtalgsapdamtelvvrqpdylvtfaslwasvnvedwkcwarwrlirarapwltral
vaedfefygrtltgaqqlrdrwkrgvslvenlmgdavgklyvqrhfppdaksridtlvdn
lqeayrisiseldwmtpqtrqralaklnkftakvgypikwrdysklaidrddlygnvqrg
yavnhdrelaklfgpvdrdewfmtpqtvnayynpgmneivfpaailqppffdpqadeaan
yggigavigheighgfddqgakydgdgnlvdwwtdddrtefaartkalieqyhaytprdl
vdhpgpphvqgaftigenigdlgglsiallayqlslngnpapvidgltgmqrvffgwaqi
wrtksraaeairrlavdphsppefrcngvvrnvdafyqafdvteddalfldpqrrvriwn

Sequence, based on observed residues (ATOM records): (download)

>d3zukb_ d.92.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
aipsgidlshidadarpqddlfghvngrwlaeheipadratdgafrslfdraetqvrdli
iqasqagaavgtdaqrigdlyasfldeeaveragvqplhdelatidsaadatelaaalgt
lqragvgggigvyvdtdskdstrylvhftqsgiglpdesyyrdeqhaavlaaypghiarm
fglvyggesrdhaktadrivaletkladahwdvvkrrdadlgynlrtfaqlqtegagfdw
vswvtalgsapdamtelvvrqpdylvtfaslwasvnvedwkcwarwrlirarapwltral
vaedfefygrtltgaqqlrdrwkrgvslvenlmgdavgklyvqrhfaksridtlvdnlqe
ayrisiseldwmtpqtrqralaklnkftakvgypikwrdysklaidrddlygnvqrgyav
nhdrelaklfgpvdrdewfmtpqtvnayynpgmneivfpaailqppffdpqadeaanygg
igavigheighgfddqgakydgdgnlvdwwtdddrtefaartkalieqyhaytprdlvdh
pgpphvqgaftigenigdlgglsiallayqlslngnpapvidgltgmqrvffgwaqiwrt
ksraaeairrlavdphsppefrcngvvrnvdafyqafdvteddalfldpqrrvriwn

SCOPe Domain Coordinates for d3zukb_:

Click to download the PDB-style file with coordinates for d3zukb_.
(The format of our PDB-style files is described here.)

Timeline for d3zukb_: