SCOP 1.57: Domain d1bosh_: 1bos H:

Lineage for d1bosh_ (1bos H:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species)

7. Species Escherichia coli [TaxId:562] [50211] (12 PDB entries)

8. Domain d1bosh_: 1bos H: [25082]

Details for d1bosh_

PDB Entry: 1bos, 2.8 Å

PDB Description: shiga-like toxin complexed with its receptor

SCOP Domain Sequences for d1bosh_:

Sequence; same for both SEQRES and ATOM records:

>d1bosh_ b.40.2.1 (H:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

Timeline for d1bosh_:

• d1bosh_ first appeared (with stable ids) in SCOP 1.55
  
• d1bosh_ appears in SCOP 1.59
  
• d1bosh_ appears in the current release, SCOPe 2.08