Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily) unusual fold |
Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) automatically mapped to Pfam PF03717 |
Family d.175.1.0: automated matches [227232] (1 protein) not a true family |
Protein automated matches [226981] (10 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [256159] (3 PDB entries) |
Domain d3zg5b2: 3zg5 B:139-327 [250789] Other proteins in same PDB: d3zg5a1, d3zg5a3, d3zg5b1, d3zg5b3 automated match to d1vqqa2 complexed with cd, cl |
PDB Entry: 3zg5 (more details), 2.55 Å
SCOPe Domain Sequences for d3zg5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zg5b2 d.175.1.0 (B:139-327) automated matches {Staphylococcus aureus [TaxId: 1280]} dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk kdgkdiqlt
Timeline for d3zg5b2: