Lineage for d3zg5a3 (3zg5 A:328-668)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949998Protein automated matches [190161] (23 species)
    not a true protein
  7. 1950199Species Staphylococcus aureus [TaxId:1280] [189852] (8 PDB entries)
  8. 1950210Domain d3zg5a3: 3zg5 A:328-668 [250787]
    Other proteins in same PDB: d3zg5a1, d3zg5a2, d3zg5b1, d3zg5b2
    automated match to d1vqqa3
    complexed with cd, cl

Details for d3zg5a3

PDB Entry: 3zg5 (more details), 2.55 Å

PDB Description: crystal structure of pbp2a from mrsa in complex with peptidoglycan analogue at allosteric
PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d3zg5a3:

Sequence, based on SEQRES records: (download)

>d3zg5a3 e.3.1.1 (A:328-668) automated matches {Staphylococcus aureus [TaxId: 1280]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpnm
mmainvkdvqdkgmasynakisgkvydelyengnkkydide

Sequence, based on observed residues (ATOM records): (download)

>d3zg5a3 e.3.1.1 (A:328-668) automated matches {Staphylococcus aureus [TaxId: 1280]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkgrqigwfisydkdnpnmmmainv
kdvqdkgmasynakisgkvydelyengnkkydide

SCOPe Domain Coordinates for d3zg5a3:

Click to download the PDB-style file with coordinates for d3zg5a3.
(The format of our PDB-style files is described here.)

Timeline for d3zg5a3: