SCOPe 2.04: Domain d3zg5a1: 3zg5 A:27-138

Lineage for d3zg5a1 (3zg5 A:27-138)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (19 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [256158] (3 PDB entries)

8. Domain d3zg5a1: 3zg5 A:27-138 [250785]
   Other proteins in same PDB: d3zg5a2, d3zg5a3, d3zg5b2, d3zg5b3
   automated match to d1vqqa1
   complexed with cd, cl

Details for d3zg5a1

PDB Entry: 3zg5, 2.55 Å

PDB Description: crystal structure of pbp2a from mrsa in complex with peptidoglycan analogue at allosteric

PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d3zg5a1:

Sequence; same for both SEQRES and ATOM records:

>d3zg5a1 d.17.4.0 (A:27-138) automated matches {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Timeline for d3zg5a1:

• d3zg5a1 is new in SCOPe 2.04-stable
  
• d3zg5a1 appears in SCOPe 2.05
  
• d3zg5a1 appears in the current release, SCOPe 2.08