Lineage for d3zf4a_ (3zf4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818270Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2818271Protein automated matches [191182] (20 species)
    not a true protein
  7. 2818502Species Staphylococcus phage [TaxId:53369] [256154] (11 PDB entries)
  8. 2818511Domain d3zf4a_: 3zf4 A: [250771]
    automated match to d4gv8c_
    complexed with dup, mg, ni; mutant

Details for d3zf4a_

PDB Entry: 3zf4 (more details), 3.1 Å

PDB Description: Phage dUTPases control transfer of virulence genes by a proto- oncogenic G protein-like mechanism. (Staphylococcus bacteriophage 80alpha dUTPase Y81A mutant with dUpNHpp).
PDB Compounds: (A:) dutpase

SCOPe Domain Sequences for d3zf4a_:

Sequence, based on SEQRES records: (download)

>d3zf4a_ b.85.4.0 (A:) automated matches {Staphylococcus phage [TaxId: 53369]}
tntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
tsrsgvsskthlvietgkidagahgnlginikndheddkmqtiflrnidnekifekerhl
yklgsyriekgeriaqlvivpiwtpelkqveefesvsergekgfgssg

Sequence, based on observed residues (ATOM records): (download)

>d3zf4a_ b.85.4.0 (A:) automated matches {Staphylococcus phage [TaxId: 53369]}
tntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
tsrsgvsskthlvietgkidagahgnlginikndheddkmqtiflrnidnekifekerhl
yklgsyriekgeriaqlvivpiwtpelkqveefeergekfgssg

SCOPe Domain Coordinates for d3zf4a_:

Click to download the PDB-style file with coordinates for d3zf4a_.
(The format of our PDB-style files is described here.)

Timeline for d3zf4a_: