Lineage for d1bove_ (1bov E:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 798735Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 798736Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 799053Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 799054Species Escherichia coli [TaxId:562] [50211] (13 PDB entries)
  8. 799124Domain d1bove_: 1bov E: [25074]
    complexed with zn

Details for d1bove_

PDB Entry: 1bov (more details), 2.2 Å

PDB Description: crystal structure of the cell-binding b oligomer of verotoxin-1 from e. coli
PDB Compounds: (E:) verotoxin-1

SCOP Domain Sequences for d1bove_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bove_ b.40.2.1 (E:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOP Domain Coordinates for d1bove_:

Click to download the PDB-style file with coordinates for d1bove_.
(The format of our PDB-style files is described here.)

Timeline for d1bove_: