SCOPe 2.08: Domain d3vx4d_: 3vx4 D:

Lineage for d3vx4d_ (3vx4 D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:210007] [256145] (1 PDB entry)

8. Domain d3vx4d_: 3vx4 D: [250719]
   automated match to d1jj7a_
   complexed with atp, mg

Details for d3vx4d_

PDB Entry: 3vx4, 2.69 Å

PDB Description: Crystal Structure of the Nucleotide-Binding Domain of S. mutans ComA, a Bifunctional ATP-binding Cassette Transporter Involved in the Quorum-sensing Pathway

PDB Compounds: (D:) Putative ABC transporter, ATP-binding protein ComA

SCOPe Domain Sequences for d3vx4d_:

Sequence; same for both SEQRES and ATOM records:

>d3vx4d_ c.37.1.0 (D:) automated matches {Streptococcus mutans [TaxId: 210007]}
nsfldgdisfenlsykygfgrdtlsdinlsikkgskvslvgasgsgkttlaklivnfyep
nkgivringndlkvidktalrrhisylpqqayvfsgsimdnlvlgakegtsqediirace
iaeirsdieqmpqgyqtelsdgagisggqkqrialaralltqapvlildaatssldilte
kkiisnllqmtektiifvahrlsisqrtdevivmdqgkiveqgthkellakqgfyynlfn

Timeline for d3vx4d_:

• d3vx4d_ first appeared in SCOPe 2.04
  
• d3vx4d_ appears in SCOPe 2.07