Lineage for d3vwjc2 (3vwj C:118-206)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362993Domain d3vwjc2: 3vwj C:118-206 [250715]
    Other proteins in same PDB: d3vwja1, d3vwja2, d3vwja3, d3vwjb_, d3vwjc1, d3vwjd1, d3vwjd2
    automated match to d2pyfa2
    complexed with db3, mg, nag

Details for d3vwjc2

PDB Entry: 3vwj (more details), 3.09 Å

PDB Description: ternary crystal structure of the human nkt tcr-cd1d-c20:2 complex
PDB Compounds: (C:) NKT15 T cell receptor alpha-chain

SCOPe Domain Sequences for d3vwjc2:

Sequence, based on SEQRES records: (download)

>d3vwjc2 b.1.1.2 (C:118-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d3vwjc2 b.1.1.2 (C:118-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
inpdpavyqlrdssvclftdfdsqtnvsqsksdvyitdkcvldmrsmdfksnsavawsdf
acanafnnsiipedtffps

SCOPe Domain Coordinates for d3vwjc2:

Click to download the PDB-style file with coordinates for d3vwjc2.
(The format of our PDB-style files is described here.)

Timeline for d3vwjc2: