Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) |
Domain d3vwja2: 3vwj A:184-278 [250712] Other proteins in same PDB: d3vwja1, d3vwjb_, d3vwjc2 automated match to d3hujc2 complexed with db3, mg, nag |
PDB Entry: 3vwj (more details), 3.09 Å
SCOPe Domain Sequences for d3vwja2:
Sequence, based on SEQRES records: (download)
>d3vwja2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw ylratldvvageaaglscrvkhsslegqdivlywh
>d3vwja2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvkpkawlsrgpspgrlllvchvsgfypkpvwvkwmeqqgtqpgdilpnadetwylratl dvscrvkhsslegqdivlywh
Timeline for d3vwja2: